быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MARK2 Rabbit mAb (A6512)
- Описание
- Характеристики
-
Overview
Product name MARK2 Rabbit mAb Catalog No. A6512 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1862 Background
This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 689-788 of human MARK2 (Q7KZI7). Sequence KPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL Gene ID Swiss Prot Synonyms EMK1; EMK-1; PAR-1; Par1b; Par-1b Calculated MW 88kDa Observed MW 88kDa/92kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples BT-474, Raji, Mouse brain, Rat brain Cellular location Cell membrane, Cytoplasm, Lateral cell membrane, Peripheral membrane protein, cytoskeleton 
Western blot analysis of extracts of various cell lines, using MARK2 Rabbit mAb (A6512) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 689-788 of human MARK2 (Q7KZI7). Isotype IgG