быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HSPA2 Rabbit mAb (A6652)
- Описание
- Характеристики
-
Overview
Product name HSPA2 Rabbit mAb Catalog No. A6652 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1415 Background
Enables disordered domain specific binding activity; enzyme binding activity; and unfolded protein binding activity. Involved in negative regulation of inclusion body assembly and protein refolding. Located in cytosol.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 488-637 of human HSPA2 (P54652). Sequence ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE Gene ID Swiss Prot Synonyms HSP70-2; HSP70-3 Calculated MW 70kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse lung, Mouse brain, A-431, Rat brain Cellular location blood microparticle, cell surface, cytoplasm, cytosol, extracellular exosome, male germ cell nucleus, meiotic spindle, nucleus, plasma membrane 
Western blot analysis of extracts of various cell lines, using HSPA2 Rabbit mAb (A6652) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using HSPA2 Rabbit mAb (A6652) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of C6 cells using HSPA2 Rabbit mAb (A6652) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using HSPA2 Rabbit mAb (A6652) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 488-637 of human HSPA2 (P54652). Isotype IgG