быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PKC delta Rabbit mAb (A7778)
- Описание
- Характеристики
-
Overview
Product name PKC delta Rabbit mAb Catalog No. A7778 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1434 Background
The protein encoded by this gene is a member of the protein kinase C family of serine- and threonine-specific protein kinases. The encoded protein is activated by diacylglycerol and is both a tumor suppressor and a positive regulator of cell cycle progression. Also, this protein can positively or negatively regulate apoptosis. Defects in this gene are a cause of autoimmune lymphoproliferative syndrome.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 547-653 of human PKC delta (Q05655). Sequence PFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLID Gene ID Swiss Prot Synonyms MAY1; PKCD; ALPS3; CVID9; nPKC-delta Calculated MW 78kDa Observed MW 78kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, NIH/3T3, SH-SY5Y, Mouse brain, Rat brain Cellular location Cell membrane, Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus, Peripheral membrane protein, perinuclear region 
Western blot analysis of extracts of various cell lines, using PKC delta Rabbit mAb (A7778) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using PKC delta Rabbit mAb (A7778) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using PKC delta Rabbit mAb (A7778) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using PKC delta Rabbit mAb (A7778) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 547-653 of human PKC delta (Q05655). Isotype IgG