быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Sec23A Rabbit mAb (A8613)
- Описание
- Характеристики
-
Overview
Product name Sec23A Rabbit mAb Catalog No. A8613 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1754 Background
The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family. It is part of a protein complex and found in the ribosome-free transitional face of the endoplasmic reticulum (ER) and associated vesicles. This protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The encoded protein is suggested to play a role in the ER-Golgi protein trafficking.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human Sec23AA (Q15436). Sequence MVVGDELKTPIRSWHDIDKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEMKCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMHGQFKM Gene ID Swiss Prot Synonyms CLSD; hSec23A Calculated MW 86kDa Observed MW 85kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Hep G2 Cellular location Cytoplasmic vesicle, Endoplasmic reticulum membrane, Cytoplasm, cytosol 
Western blot analysis of extracts of Hep G2 cells, using Sec23AA Rabbit mAb (A8613) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat ovary using Sec23AA Rabbit mAb (A8613) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human appendix using Sec23AA Rabbit mAb (A8613) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using Sec23AA Rabbit mAb (A8613) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH/3T3 cells using Sec23AA Rabbit mAb (A8613) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human Sec23AA (Q15436). Isotype IgG