быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SOX10 Rabbit mAb (A8658)
- Описание
- Характеристики
-
Overview
Product name SOX10 Rabbit mAb Catalog No. A8658 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1768 Background
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SOX10 (P56693). Sequence VDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSH Gene ID Swiss Prot Synonyms DOM; WS4; PCWH; WS2E; WS4C; SOX-10 Calculated MW 31kDa/50kDa Observed MW 60-70kDa Applications
Reactivity Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples C6, Mouse brain, Rat brain Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using SOX10 Rabbit mAb (A8658) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of C6 cells using SOX10 Rabbit mAb (A8658) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of C6 cells using 3 μg SOX10 antibody (A8658). Western blot was performed from the immunoprecipitate using SOX10 antibody (A8658) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SOX10 (P56693). Isotype IgG