быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PEN2/PSENEN Rabbit mAb (A8678)
- Описание
- Характеристики
-
Overview
Product name PEN2/PSENEN Rabbit mAb Catalog No. A8678 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1779 Background
Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human PEN2/PSENEN (NP_758844.1) Sequence MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP Gene ID Swiss Prot Synonyms PEN2; PEN-2; MDS033; ACNINV2; MSTP064 Calculated MW 12kDa Observed MW 14kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, A549, SH-SY5Y, Mouse kidney, Rat lung Cellular location endoplasmic reticulum, Golgi apparatus, mitochondrion, plasma membrane, presynaptic membrane 
Western blot analysis of extracts of various cell lines, using PEN2/PSENEN Rabbit mAb (A8678) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of NIH/3T3 cells using PEN2/PSENEN Rabbit mAb (A8678) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human PEN2/PSENEN (NP_758844.1) Isotype IgG







