быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FXR1 Rabbit mAb (A8697)
- Описание
- Характеристики
-
Overview
Product name FXR1 Rabbit mAb Catalog No. A8697 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1230 Background
The protein encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FXR1 (P51114). Sequence MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACD Gene ID Swiss Prot Synonyms FXR1P; CMYP9A; CMYP9B; MYOPMIL; MYORIBF Calculated MW 70kDa Observed MW 70-80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, Hep G2, NIH/3T3, U-251MG Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using FXR1 Rabbit mAb (A8697) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of C6 cells using FXR1 Rabbit mAb (A8697) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using FXR1 Rabbit mAb (A8697) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using FXR1 Rabbit mAb (A8697) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FXR1 (P51114). Isotype IgG