быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MFF Rabbit mAb (A8700)
- Описание
- Характеристики
-
Overview
Product name MFF Rabbit mAb Catalog No. A8700 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1243 Background
This is a nuclear gene encoding a protein that functions in mitochondrial and peroxisomal fission. The encoded protein recruits dynamin-1-like protein (DNM1L) to mitochondria. There are multiple pseudogenes for this gene on chromosomes 1, 5, and X. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MFF (Q9GZY8). Sequence TPSPQQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQI Gene ID Swiss Prot Synonyms EMPF2; GL004; C2orf33 Calculated MW 38kDa Observed MW 35kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples C2C12, C6, Rat brain Cellular location Cytoplasmic vesicle, Mitochondrion outer membrane, Peroxisome, Single-pass type IV membrane protein, secretory vesicle, synaptic vesicle 
Western blot analysis of extracts of various cell lines, using MFF Rabbit mAb (A8700) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MFF (Q9GZY8). Isotype IgG