быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MYL9 Rabbit mAb (A8738)
- Описание
- Характеристики
-
Overview
Product name MYL9 Rabbit mAb Catalog No. A8738 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1284 Background
Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (P24844). Sequence MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPE Gene ID Swiss Prot Synonyms LC20; MLC2; MRLC1; MYRL2; MLC-2C; MMIHS4 Calculated MW 20kDa Observed MW 20kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, C2C12, Mouse lung Cellular location cell cortex, cytoplasm, cytosol, myofibril, Z disc 
Western blot analysis of extracts of various cell lines, using MYL9 Rabbit mAb (A8738) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (P24844). Isotype IgG