быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
eEF1G Rabbit mAb (A8744)
- Описание
- Характеристики
-
Overview
Product name eEF1G Rabbit mAb Catalog No. A8744 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1287 Background
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human eEF1G (P26641). Sequence MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHH Gene ID Swiss Prot Synonyms EF1G; GIG35 Calculated MW 50kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HT-29, BxPC-3, U-251MG, Mouse brain, Rat testis Cellular location Cytoplasm, cytosol, extracellular exosome, nucleus 
Western blot analysis of extracts of various cell lines, using eEF1G Rabbit mAb (A8744) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat brain using eEF1G Rabbit mAb (A8744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human placenta using eEF1G Rabbit mAb (A8744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using eEF1G Rabbit mAb (A8744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using eEF1G Rabbit mAb (A8744) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using eEF1G Rabbit mAb (A8744) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human eEF1G (P26641). Isotype IgG