быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PRKRA/PACT Rabbit mAb (A8779)
- Описание
- Характеристики
-
Overview
Product name PRKRA/PACT Rabbit mAb Catalog No. A8779 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1299 Background
This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 214-313 of human PRKRA/PACT (O75569). Sequence TWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAHNALQYLKIIAERK Gene ID Swiss Prot Synonyms RAX; PACT; DYT16; HSD14 Calculated MW 34kDa Observed MW 34kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, PC-12, Mouse testis Cellular location Cytoplasm, Perinuclear region 
Western blot analysis of extracts of various cell lines, using PRKRA/PACTRabbit mAb (A8779) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat brain using PRKRA/PACTRabbit mAb (A8779) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human brain using PRKRA/PACTRabbit mAb (A8779) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using PRKRA/PACTRabbit mAb (A8779) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 214-313 of human PRKRA/PACT (O75569). Isotype IgG