быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
RBP4 Rabbit mAb (A8807)
- Описание
- Характеристики
-
Overview
Product name RBP4 Rabbit mAb Catalog No. A8807 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1311 Background
This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 102-201 of human RBP4 (P02753). Sequence AKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL Gene ID Swiss Prot Synonyms RDCCAS; MCOPCB10 Calculated MW 21kDa Observed MW 22kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Hep G2 Cellular location Extracellular exosome, Extracellular region, Extracellular space 
Western blot analysis of extracts of HepG2 cells, using RBP4 antibody (A8807) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunofluorescence analysis of rat liver using RBP4 Rabbit mAb (A8807) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of human liver using RBP4 Rabbit mAb (A8807) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse liver using RBP4 Rabbit mAb (A8807) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 102-201 of human RBP4 (P02753). Isotype IgG