быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BST2 Rabbit mAb (A8839)
- Описание
- Характеристики
-
Overview
Product name BST2 Rabbit mAb Catalog No. A8839 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1321 Background
Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human BST2 (Q10589). Sequence LQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIAD Gene ID Swiss Prot Synonyms CD317; HM1.24; TETHERIN Calculated MW 20kDa Observed MW 35kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse liver, Rat liver Cellular location Apical cell membrane, Cell membrane, Cytoplasm, GPI-anchor, Golgi apparatus, Late endosome, Lipid-anchor, Membrane raft, Single-pass type II membrane protein, trans-Golgi network 
Western blot analysis of extracts of various cell lines, using BST2 Rabbit mAb (A8839) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human BST2 (Q10589). Isotype IgG