быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FABPI Rabbit mAb (A8895)
- Описание
- Характеристики
-
Overview
Product name FABPI Rabbit mAb Catalog No. A8895 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1343 Background
The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABPI (P12104). Sequence MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNG Gene ID Swiss Prot Synonyms FABPI; I-FABP Calculated MW 15kDa Observed MW 14kDa Applications
Reactivity Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse small intestine, Rat small intestine Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using FABPI Rabbit mAb (A8895) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded rat intestine using FABPI Rabbit mAb (A8895) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse intestin using FABPI Rabbit mAb (A8895) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of mouse intestin using FABPI Rabbit mAb (A8895) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABPI (P12104). Isotype IgG