быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MBD3 Rabbit mAb (A8905)
- Описание
- Характеристики
-
Overview
Product name MBD3 Rabbit mAb Catalog No. A8905 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2466 Background
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. This gene belongs to a family of nuclear proteins which are characterized by the presence of a methyl-CpG binding domain (MBD). The encoded protein is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. Unlike the other family members, the encoded protein is not capable of binding to methylated DNA. The protein mediates the association of metastasis-associated protein 2 with the core histone deacetylase complex. Alternative splicing results in multiple transcript variants of this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MBD3 (O95983). Sequence MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALP Gene ID Swiss Prot Synonyms MBD3; methyl-CpG-binding domain protein 3 Calculated MW 33kDa Observed MW 32kDa/34kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, U-251MG, C6, Mouse lung, Mouse brain Cellular location Chromosome, Nucleus 
Western blot analysis of extracts of various cell lines, using MBD3 Rabbit mAb (A8905) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using MBD3 Rabbit mAb (A8905) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using MBD3 Rabbit mAb (A8905) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MBD3 (O95983). Isotype IgG