быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LTA4H Rabbit mAb (A8918)
- Описание
- Характеристики
-
Overview
Product name LTA4H Rabbit mAb Catalog No. A8918 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1351 Background
The protein encoded by this gene is an enzyme that contains both hydrolase and aminopeptidase activities. The hydrolase activity is used in the final step of the biosynthesis of leukotriene B4, a proinflammatory mediator. The aminopeptidase activity has been shown to degrade proline-glycine-proline (PGP), a neutrophil chemoattractant and biomarker for chronic obstructive pulmonary disease (COPD). Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 501-600 of human LTA4H (P09960). Sequence NEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT Gene ID Swiss Prot Synonyms LTA4H; leukotriene A4 hydrolase Calculated MW 69kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Hep G2, U-937, Mouse lung, Mouse brain, Mouse spleen, Rat lung, Rat kidney Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using LTA4H Rabbit mAb (A8918) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of C6 cells using LTA4H Rabbit mAb (A8918) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using LTA4H Rabbit mAb (A8918) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 501-600 of human LTA4H (P09960). Isotype IgG