быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
hnRNP C Rabbit mAb (A8958)
- Описание
- Характеристики
-
Overview
Product name hnRNP C Rabbit mAb Catalog No. A8958 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1366 Background
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-170 of human hnRNP C (P07910). Sequence LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGK Gene ID Swiss Prot Synonyms C1; C2; HNRNP; HNRPC; SNRPC Calculated MW 34kDa Observed MW 40kDa/42kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Jurkat, Mouse thymus Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using hnRNP C Rabbit mAb (A8958) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of U-2 OS cells using hnRNP C Rabbit mAb (A8958) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-170 of human hnRNP C (P07910). Isotype IgG