быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Pyruvate carboxylase (PC) Rabbit mAb (A8980)
- Описание
- Характеристики
-
Overview
Product name Pyruvate carboxylase (PC) Rabbit mAb Catalog No. A8980 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1371 Background
This gene encodes pyruvate carboxylase, which requires biotin and ATP to catalyse the carboxylation of pyruvate to oxaloacetate. The active enzyme is a homotetramer arranged in a tetrahedron which is located exclusively in the mitochondrial matrix. Pyruvate carboxylase is involved in gluconeogenesis, lipogenesis, insulin secretion and synthesis of the neurotransmitter glutamate. Mutations in this gene have been associated with pyruvate carboxylase deficiency. Alternatively spliced transcript variants with different 5' UTRs, but encoding the same protein, have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyruvate carboxylase (PC) (P11498). Sequence MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIP Gene ID Swiss Prot Synonyms PCB; PC Calculated MW 130kDa Observed MW 130kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, Mouse liver, Mouse brain, Mouse kidney, Rat liver Cellular location Mitochondrion matrix 
Western blot analysis of extracts of various cell lines, using Pyruvate carboxylase (PC) Rabbit mAb (A8980) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyruvate carboxylase (PC) (P11498). Isotype IgG







