быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SUMO4 Rabbit mAb (A9016)
- Описание
- Характеристики
-
Overview
Product name SUMO4 Rabbit mAb Catalog No. A9016 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1382 Background
This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO4 (Q6EEV6). Sequence MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY Gene ID Swiss Prot Synonyms IDDM5; SMT3H4; SUMO-4; dJ281H8.4 Calculated MW 11kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T, A-431, Raji, Mouse lung, Mouse brain, Rat lung Cellular location nucleus 
Western blot analysis of extracts of various cell lines, using SUMO4 Rabbit mAb (A9016) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using SUMO4 Rabbit mAb (A9016) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using SUMO4 Rabbit mAb (A9016) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of U-2 OS cells using SUMO4 Rabbit mAb (A9016) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO4 (Q6EEV6). Isotype IgG