быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FHIT Rabbit mAb (A9072)
- Описание
- Характеристики
-
Overview
Product name FHIT Rabbit mAb Catalog No. A9072 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1401 Background
The protein encoded by this gene is a P1-P3-bis(5'-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. The encoded protein is also a tumor suppressor, as loss of its activity results in replication stress and DNA damage.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FHIT (P49789). Sequence MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVL Gene ID Swiss Prot Synonyms FRA3B; AP3Aase Calculated MW 17kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, Rat liver, Rat spleen Cellular location Cytoplasm, Mitochondrion, Nucleus 
Western blot analysis of extracts of various cell lines, using FHIT Rabbit mAb (A9072) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FHIT (P49789). Isotype IgG