быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HSP20/HSPB6 Rabbit mAb (A9091)
- Описание
- Характеристики
-
Overview
Product name HSP20/HSPB6 Rabbit mAb Catalog No. A9091 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1787 Background
This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human HSP20/HSPB6 (O14558). Sequence DPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS Gene ID Swiss Prot Synonyms HEL55; Hsp20; PPP1R91 Calculated MW 17kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse heart, Rat skeletal muscle Cellular location Cytoplasm, Nucleus, Translocates to nuclear foci during heat shock 
Western blot analysis of extracts of various cell lines, using HSP20/HSPB6 Rabbit mAb (A9091) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat heart using HSP20/HSPB6 Rabbit mAb (A9091) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using HSP20/HSPB6 Rabbit mAb (A9091) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using HSP20/HSPB6 Rabbit mAb (A9091) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat heart using HSP20/HSPB6 Rabbit mAb (A9091) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human HSP20/HSPB6 (O14558). Isotype IgG