быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
p70 S6 Kinase 2 Rabbit mAb (A9100)
- Описание
- Характеристики
-
Overview
Product name p70 S6 Kinase 2 Rabbit mAb Catalog No. A9100 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1790 Background
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human p70 S6 Kinase 2 (Q9UBS0). Sequence MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER Gene ID Swiss Prot Synonyms KLS; SRK; S6K2; S6KB; STK14B; S6KI(2); S6Kbeta; p70S6Kb; P70-beta; S6K-beta2; P70-beta-1; P70-beta-2; p70(S6K)-beta Calculated MW 53kDa Observed MW 60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse brain Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of Mouse brain, using p70 S6 Kinase 2 Rabbit mAb (A9100) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded rat ovary using p70 S6 Kinase 2 Rabbit mAb (A9100) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using p70 S6 Kinase 2 Rabbit mAb (A9100) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using p70 S6 Kinase 2 Rabbit mAb (A9100) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using p70 S6 Kinase 2 Rabbit mAb (A9100) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using p70 S6 Kinase 2 Rabbit mAb (A9100) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human p70 S6 Kinase 2 (Q9UBS0). Isotype IgG