быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LGR6 Rabbit mAb (A9128)
- Описание
- Характеристики
-
Overview
Product name LGR6 Rabbit mAb Catalog No. A9128 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1440 Background
This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane protein superfamily. The encoded protein is a glycoprotein hormone receptor with a large N-terminal extracellular domain that contains leucine-rich repeats important for the formation of a horseshoe-shaped interaction motif for ligand binding. Alternative splicing of this gene results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 801-900 of human LGR6 (Q9HBX8). Sequence FPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRRLRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVT Gene ID Swiss Prot Synonyms GPCR; VTS20631 Calculated MW 104kDa Observed MW 104kDa Applications
Reactivity Human, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, MCF7, Rat testis Cellular location Cytoplasm, Nucleus, Cell membrane, Membrane, clathrin-coated pit 
Western blot analysis of extracts of various cell lines, using LGR6 Rabbit mAb (A9128) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of Rat testis, using LGR6 Rabbit mAb (A9128) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of HeLa cells using LGR6 Rabbit mAb (A9128) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 801-900 of human LGR6 (Q9HBX8). Isotype IgG