быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Hemopexin (HPX) Rabbit mAb (A9133)
- Описание
- Характеристики
-
Overview
Product name Hemopexin (HPX) Rabbit mAb Catalog No. A9133 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1444 Background
This gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 363-462 of human Hemopexin (HPX) (P02790). Sequence AFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH Gene ID Swiss Prot Synonyms HX Calculated MW 52kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Human serum, Mouse lung Cellular location Secreted 
Western blot analysis of extracts of Mouse lung, using Hemopexin (HPX) (HPX) Rabbit mAb (A9133) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 2min.
Western blot analysis of extracts of Human serum, using Hemopexin (HPX) (HPX) Rabbit mAb (A9133) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat liver using Hemopexin (HPX) (HPX) Rabbit mAb (A9133) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat liver using Hemopexin (HPX) (HPX) Rabbit mAb (A9133) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of human liver using Hemopexin (HPX) (HPX) Rabbit mAb (A9133) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse liver using Hemopexin (HPX) (HPX) Rabbit mAb (A9133) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 363-462 of human Hemopexin (HPX) (P02790). Isotype IgG