быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
KIF2C/MCAK Rabbit mAb (A9140)
- Описание
- Характеристики
-
Overview
Product name KIF2C/MCAK Rabbit mAb Catalog No. A9140 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1447 Background
This gene encodes a kinesin-like protein that functions as a microtubule-dependent molecular motor. The encoded protein can depolymerize microtubules at the plus end, thereby promoting mitotic chromosome segregation. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF2C/KIF2C/MCAK (Q99661). Sequence MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI Gene ID Swiss Prot Synonyms MCAK; CT139; KNSL6 Calculated MW 81kDa Observed MW 85kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples MCF7, PC-3, Jurkat Cellular location Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, kinetochore 
Western blot analysis of extracts of various cell lines, using KIF2C/KIF2C/MCAK Rabbit mAb (A9140) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF2C/KIF2C/MCAK (Q99661). Isotype IgG