быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Prohibitin 2 (PHB2) Rabbit mAb (A9144)
- Описание
- Характеристики
-
Overview
Product name Prohibitin 2 (PHB2) Rabbit mAb Catalog No. A9144 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1449 Background
Enables several functions, including protein C-terminus binding activity; protein N-terminus binding activity; and protein dimerization activity. Involved in several processes, including defense response to virus; positive regulation of cell cycle phase transition; and regulation of transcription, DNA-templated. Located in several cellular components, including cell surface; mitochondrial membrane; and nuclear matrix. Part of mitochondrial prohibitin complex.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin 2 (Prohibitin 2 (PHB2)) (Q99623). Sequence QMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAK Gene ID Swiss Prot Synonyms BAP; REA; p22; hBAP; Bap37; BCAP37; PNAS-141 Calculated MW 33kDa Observed MW 33kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:3000 - 1:6000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples HeLa, SKOV3, HT-1080, NIH/3T3, C6, Mouse liver, Mouse heart Cellular location Cytoplasm, Mitochondrion inner membrane, Nucleus 
Western blot analysis of extracts of various cell lines, using Prohibitin 2 (Prohibitin 2 (PHB2)) Rabbit mAb (A9144) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Prohibitin 2 (Prohibitin 2 (PHB2)) Rabbit mAb (A9144) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH/3T3 cells using Prohibitin 2 (Prohibitin 2 (PHB2)) Rabbit mAb (A9144) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using Prohibitin 2 (Prohibitin 2 (PHB2)) Rabbit mAb (A9144) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of SKOV3 cells using 3 μg Prohibitin 2 (PHB2) antibody (A9144). Western blot was performed from the immunoprecipitate using Prohibitin 2 (PHB2) antibody (A9144) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin 2 (Prohibitin 2 (PHB2)) (Q99623). Isotype IgG