быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Nuclear Matrix Protein p84 (THOC1) Rabbit mAb (A9269)
- Описание
- Характеристики
-
Overview
Product name Nuclear Matrix Protein p84 (THOC1) Rabbit mAb Catalog No. A9269 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1504 Background
Predicted to enable DNA binding activity and RNA binding activity. Involved in several processes, including negative regulation of DNA damage checkpoint; regulation of nucleobase-containing compound metabolic process; and viral mRNA export from host cell nucleus. Located in cytoplasm and nuclear speck. Part of THO complex part of transcription export complex. Colocalizes with chromosome, telomeric region.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nuclear Matrix Protein p84 (THOC1) (NP_005122.2). Sequence SLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNME Gene ID Swiss Prot Synonyms P84; HPR1; P84N5; DFNA86 Calculated MW 76kDa Observed MW 85kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, Raji, Mouse testis, Mouse brain, Mouse spleen Cellular location Cytoplasm, Cytoplasm, Nucleus, Nucleus matrix, Nucleus speckle, Nucleoplasm 
Western blot analysis of extracts of various cell lines, using Nuclear Matrix Protein p84 (THOC1) (THOC1) Rabbit mAb (A9269) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nuclear Matrix Protein p84 (THOC1) (NP_005122.2). Isotype IgG