быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CAMKIV Rabbit mAb (A9271)
- Описание
- Характеристики
-
Overview
Product name CAMKIV Rabbit mAb Catalog No. A9271 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1506 Background
The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 374-473 of human CAMKIV (Q16566). Sequence EGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY Gene ID Swiss Prot Synonyms caMK; CaMKIV; CaMK IV; CaMK-GR Calculated MW 52kDa Observed MW 60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples SH-SY5Y, Mouse thymus Cellular location cytoplasm, extracellular exosome, fibrillar center, glutamatergic synapse, nucleoplasm, nucleus 
Western blot analysis of extracts of various cell lines, using CAMKIV antibody (A9271) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded rat brain using CAMKIV Rabbit mAb (A9271) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using CAMKIV Rabbit mAb (A9271) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using CAMKIV Rabbit mAb (A9271) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using CAMKIV Rabbit mAb (A9271) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using CAMKIV Rabbit mAb (A9271) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 374-473 of human CAMKIV (Q16566). Isotype IgG