быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293)
- Описание
- Характеристики
-
Overview
Product name Hemoglobin subunit alpha (HBA1) Rabbit mAb Catalog No. A9293 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1510 Background
The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hemoglobin subunit alpha (HBA1) (HBA1) (P69905). Sequence MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK Gene ID Swiss Prot Synonyms HBH; ECYT7; HBA-T3; METHBA Calculated MW 15kDa Observed MW 11kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Rat liver Cellular location blood microparticle, cytosol, extracellular exosome, extracellular region, extracellular space, hemoglobin complex 
Western blot analysis of extracts of Rat liver, using Hemoglobin subunit alpha (HBA1) (HBA1) Rabbit mAb (A9293) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded red blood cell staining in rat kidney using Hemoglobin subunit alpha (HBA1) (HBA1) Rabbit mAb (A9293) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded blood cell staining in human placenta using Hemoglobin subunit alpha (HBA1) (HBA1) Rabbit mAb (A9293) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded blood cell staining in mouse lung using Hemoglobin subunit alpha (HBA1) (HBA1) Rabbit mAb (A9293) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human breast cancer using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human kidney using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human tonsil using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse liver using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat lung using Hemoglobin subunit alpha (HBA1) Rabbit mAb (A9293) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat spleen using Hemoglobin subunit alpha (HBA1) (HBA1) Rabbit mAb (A9293) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of human spleen using Hemoglobin subunit alpha (HBA1) (HBA1) Rabbit mAb (A9293) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse spleen using Hemoglobin subunit alpha (HBA1) (HBA1) Rabbit mAb (A9293) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hemoglobin subunit alpha (HBA1) (HBA1) (P69905). Isotype IgG