быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DHFR Rabbit mAb (A9299)
- Описание
- Характеристики
-
Overview
Product name DHFR Rabbit mAb Catalog No. A9299 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1513 Background
Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 88-187 of human DHFR (NP_000782.1). Sequence HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND Gene ID Swiss Prot Synonyms DYR; DHFR1; DHFRP1 Calculated MW 21kDa Observed MW 21kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, Hep G2, C2C12, Mouse liver, Rat kidney Cellular location Mitochondrion, Cytoplasm 
Western blot analysis of extracts of various cell lines, using DHFR Rabbit mAb (A9299) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 88-187 of human DHFR (NP_000782.1). Isotype IgG