быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cyclin E2 Rabbit mAb (A9305)
- Описание
- Характеристики
-
Overview
Product name Cyclin E2 Rabbit mAb Catalog No. A9305 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1515 Background
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Cyclin E2 (O96020). Sequence HQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLL Gene ID Swiss Prot Synonyms CYCE2 Calculated MW 47kDa Observed MW 47kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples MCF7, Jurkat, SH-SY5Y Cellular location Nucleus Customer validation (H520)
WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using Cyclin E2 Rabbit mAb (A9305) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Cyclin E2 (O96020). Isotype IgG