быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FOXP1 Rabbit mAb (A9540)
- Описание
- Характеристики
-
Overview
Product name FOXP1 Rabbit mAb Catalog No. A9540 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1624 Background
This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen Recombinant Protein corresponding to a sequence within amino acids 550-650 of human FOXP1 (Q9H334). Sequence SGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPLDPEEAEGPLS Gene ID Swiss Prot Synonyms MFH; QRF1; 12CC4; hFKH1B; HSPC215 Calculated MW 75kDa Observed MW 90kDa/98kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, Jurkat, SH-SY5Y, Mouse brain, Mouse spleen, Rat lung, Rat brain Cellular location Nucleus 
Western blot analysis of various lysates, using FOXP1 Rabbit mAb (A9540) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of various lysates, using FOXP1 Rabbit mAb (A9540) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant Protein corresponding to a sequence within amino acids 550-650 of human FOXP1 (Q9H334). Isotype IgG