быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PSMB9/LMP2 Rabbit mAb (A9549)
- Описание
- Характеристики
-
Overview
Product name PSMB9/LMP2 Rabbit mAb Catalog No. A9549 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1629 Background
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human PSMB9/LMP2 (P28065). Sequence QREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE Gene ID Swiss Prot Synonyms LMP2; PRAAS3; PSMB6i; RING12; beta1i Calculated MW 23kDa Observed MW 21kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Raji, Mouse lung, Mouse spleen, Mouse thymus, Rat lung, Rat liver, THP-1 Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using PSMB9/LMP2 Rabbit mAb (A9549) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using PSMB9/LMP2 Rabbit mAb (A9549) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human PSMB9/LMP2 (P28065). Isotype IgG







