быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PSMD14 Rabbit mAb (A9608)
- Описание
- Характеристики
-
Overview
Product name PSMD14 Rabbit mAb Catalog No. A9608 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1655 Background
This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S proteasome and mediates substrate deubiquitination. A pseudogene of this gene is also located on the long arm of chromosome 2.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 112-210 of human PSMD14 (O00487). Sequence YHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN Gene ID Swiss Prot Synonyms PAD1; POH1; RPN11 Calculated MW 35kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, Mouse brain, Mouse thymus, Rat lung, Rat brain Cellular location cytosol, cytosolic proteasome complex, extracellular region, nucleoplasm, nucleus Customer validation WB(Homo sapiens)
IHC(Homo sapiens)
Western blot analysis of extracts of various cell lines, using PSMD14 Rabbit mAb (A9608) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat ovary using PSMD14 Rabbit mAb (A9608) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human breast using PSMD14 Rabbit mAb (A9608) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using PSMD14 Rabbit mAb (A9608) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Confocal imaging of U-2OS cells using PSMD14 Rabbit mAb (A9608, dilution 1:100) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 40x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 112-210 of human PSMD14 (O00487). Isotype IgG