быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
hnRNP Q/SYNCRIP Rabbit mAb (A9609)
- Описание
- Характеристики
-
Overview
Product name hnRNP Q/SYNCRIP Rabbit mAb Catalog No. A9609 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1656 Background
This gene encodes a member of the cellular heterogeneous nuclear ribonucleoprotein (hnRNP) family. hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA) and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. The encoded protein plays a role in multiple aspects of mRNA maturation and is associated with several multiprotein complexes including the apoB RNA editing-complex and survival of motor neurons (SMN) complex. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 20.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 524-623 of human hnRNP Q/SYNCRIP (O60506). Sequence SQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGNVGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK Gene ID Swiss Prot Synonyms PP68; NSAP1; GRYRBP; HNRNPQ; HNRPQ1; GRY-RBP; hnRNP-Q Calculated MW 70kDa Observed MW 70-85kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, Mouse brain, Mouse heart, Rat lung, Rat spleen, Rat thymus Cellular location Cytoplasm, Endoplasmic reticulum, Microsome, Nucleus, Nucleus, nucleoplasm 
Western blot analysis of extracts of various cell lines, using hnRNP Q/SYNCRIP /SYNCRIP Rabbit mAb (A9609) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using hnRNP Q/SYNCRIP /SYNCRIP Rabbit mAb (A9609) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using hnRNP Q/SYNCRIP /SYNCRIP Rabbit mAb (A9609) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using hnRNP Q/SYNCRIP /SYNCRIP Rabbit mAb (A9609) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using hnRNP Q/SYNCRIP /SYNCRIP Rabbit mAb (A9609) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using hnRNP Q/SYNCRIP /SYNCRIP Rabbit mAb (A9609) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 524-623 of human hnRNP Q/SYNCRIP (O60506). Isotype IgG