быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Caspase-14 Rabbit mAb (A9618)
- Описание
- Характеристики
-
Overview
Product name Caspase-14 Rabbit mAb Catalog No. A9618 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1661 Background
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This caspase has been shown to be processed and activated by caspase 8 and caspase 10 in vitro, and by anti-Fas agonist antibody or TNF-related apoptosis inducing ligand in vivo. The expression and processing of this caspase may be involved in keratinocyte terminal differentiation, which is important for the formation of the skin barrier.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human Caspase-14 (P31944). Sequence GEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKG Gene ID Swiss Prot Synonyms ARCI12 Calculated MW 28kDa Observed MW 17kDa/28kDa/35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y, Mouse thymus, A375, Mouse stomach, Rat lung, Rat stomach Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using Caspase-14 Rabbit mAb (A9618) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using Caspase-14 Rabbit mAb (A9618) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human Caspase-14 (P31944). Isotype IgG







