быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cytokeratin 9 (KRT9) Rabbit mAb (A9621)
- Описание
- Характеристики
-
Overview
Product name Cytokeratin 9 (KRT9) Rabbit mAb Catalog No. A9621 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1664 Background
This gene encodes the type I keratin 9, an intermediate filament chain expressed only in the terminally differentiated epidermis of palms and soles. Mutations in this gene cause epidermolytic palmoplantar keratoderma.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 254-412 of human Cytokeratin 9 (KRT9) (P35527). Sequence DADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMI Gene ID Swiss Prot Synonyms K9; CK-9; EPPK Calculated MW 62kDa Observed MW 62kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y Cellular location cytoskeleton, cytosol, extracellular exosome, extracellular space, nucleus 
Western blot analysis of extracts of SH-SY5Y cells, using Cytokeratin 9 (KRT9) (KRT9) antibody (A9621) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 254-412 of human Cytokeratin 9 (KRT9) (P35527). Isotype IgG