быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LIN28A Rabbit mAb (A9627)
- Описание
- Характеристики
-
Overview
Product name LIN28A Rabbit mAb Catalog No. A9627 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1668 Background
This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIN28A (Q9H9Z2). Sequence MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKS Gene ID Swiss Prot Synonyms CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A Calculated MW 23kDa Observed MW 26kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:2000 - 1:20000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse testis, Rat testis Cellular location Cytoplasm, Cytoplasmic stress granule, Cytosol, Nucleolus, Nucleus, P-body, rough endoplasmic reticulum 
Western blot analysis of various lysates, using Lin28 antibody (A9627) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of rat testis using LIN28A Rabbit mAb (A9627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of human ovary using LIN28A Rabbit mAb (A9627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse testis using LIN28A Rabbit mAb (A9627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIN28A (Q9H9Z2). Isotype IgG