быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MDH1 Rabbit mAb (A9673)
- Описание
- Характеристики
-
Overview
Product name MDH1 Rabbit mAb Catalog No. A9673 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1692 Background
This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Pseudogenes have been identified on chromosomes X and 6.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 235-334 of human MDH1 (P40925). Sequence IKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA Gene ID Swiss Prot Synonyms KAR; MDHA; MOR2; DEE88; MDH-s; EIEE88; HEL-S-32; MGC:1375 Calculated MW 36kDa Observed MW 36kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Jurkat, U-251MG, Mouse liver, Mouse brain, Rat kidney, Rat heart Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using MDH1 Rabbit mAb (A9673) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 235-334 of human MDH1 (P40925). Isotype IgG







