быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Parathyroid Hormone (PTH) Rabbit mAb (A9704)
- Описание
- Характеристики
-
Overview
Product name Parathyroid Hormone (PTH) Rabbit mAb Catalog No. A9704 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1709 Background
This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Parathyroid Hormone (PTH) (P01270). Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGE Gene ID Swiss Prot Synonyms FIH1; PTH1 Calculated MW 13kDa Observed MW 13kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse thymus, Rat thymus Cellular location Secreted 
Western blot analysis of extracts of various cell lines, using Parathyroid Hormone (PTH) (PTH) Rabbit mAb (A9704) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Parathyroid Hormone (PTH) (P01270). Isotype IgG