быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD166/ALCAM Rabbit mAb (A9727)
- Описание
- Характеристики
-
Overview
Product name CD166/ALCAM Rabbit mAb Catalog No. A9727 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1720 Background
This gene encodes activated leukocyte cell adhesion molecule (ALCAM), also known as CD166 (cluster of differentiation 166), which is a member of a subfamily of immunoglobulin receptors with five immunoglobulin-like domains (VVC2C2C2) in the extracellular domain. This protein binds to T-cell differentiation antigene CD6, and is implicated in the processes of cell adhesion and migration. Multiple alternatively spliced transcript variants encoding different isoforms have been found.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 484-583 of human CD166/ALCAM (Q13740). Sequence TCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA Gene ID Swiss Prot Synonyms MEMD; CD166 Calculated MW 65kDa Observed MW 100-105kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples THP-1, SH-SY5Y, Mouse lung, Mouse brain, Rat lung, Rat liver, Rat brain Cellular location Membrane, Secreted, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using CD166/ALCAM Rabbit mAb (A9727) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 484-583 of human CD166/ALCAM (Q13740). Isotype IgG