быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ApoER2/LRP8 Rabbit mAb (A9747)
- Описание
- Характеристики
-
Overview
Product name ApoER2/LRP8 Rabbit mAb Catalog No. A9747 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1730 Background
This gene encodes a member of the low density lipoprotein receptor (LDLR) family. Low density lipoprotein receptors are cell surface proteins that play roles in both signal transduction and receptor-mediated endocytosis of specific ligands for lysosomal degradation. The encoded protein plays a critical role in the migration of neurons during development by mediating Reelin signaling, and also functions as a receptor for the cholesterol transport protein apolipoprotein E. Expression of this gene may be a marker for major depressive disorder. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 864-963 of human ApoER2/LRP8 (Q14114). Sequence PVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP Gene ID Swiss Prot Synonyms MCI1; LRP-8; APOER2; HSZ75190 Calculated MW 106kDa Observed MW 100-106kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-87MG, Mouse testis, Rat testis Cellular location Cell membrane, Secreted, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using ApoER2/LRP8 Rabbit mAb (A9747) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 864-963 of human ApoER2/LRP8 (Q14114). Isotype IgG