быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IQGAP1 Rabbit mAb (A9765)
- Описание
- Характеристики
-
Overview
Product name IQGAP1 Rabbit mAb Catalog No. A9765 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1739 Background
This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IQGAP1 (NP_003861.1). Sequence MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQ Gene ID Swiss Prot Synonyms SAR1; p195; HUMORFA01 Calculated MW 189kDa Observed MW 195kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples U-87MG, Mouse lung Cellular location Cell membrane 
Western blot analysis of extracts of various cell lines, using IQGAP1 Rabbit mAb (A9765) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human liver using IQGAP1 Rabbit mAb (A9765) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IQGAP1 (NP_003861.1). Isotype IgG