быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
SLC7A11/xCT Rabbit mAb (A2413)
- Описание
- Характеристики
-
Overview
Product name SLC7A11/xCT Rabbit mAb Catalog No. A2413 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0753 Background
This gene encodes a member of a heteromeric, sodium-independent, anionic amino acid transport system that is highly specific for cysteine and glutamate. In this system, designated Xc(-), the anionic form of cysteine is transported in exchange for glutamate. This protein has been identified as the predominant mediator of Kaposi sarcoma-associated herpesvirus fusion and entry permissiveness into cells. Also, increased expression of this gene in primary gliomas (compared to normal brain tissue) was associated with increased glutamate secretion via the XCT channels, resulting in neuronal cell death.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC7A11/xCT (Q9UPY5). Sequence MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAEL Gene ID Swiss Prot Synonyms xCT; CCBR1 Calculated MW 55kDa Observed MW 37kDa/55kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, HepG2, Mouse liver, Rat liver, Rat brain Cellular location Membrane, Multi-pass membrane protein Customer validation WB(Mus musculus, Homo sapiens, Rattus norvegicus, Bos taurus, Carassius gibelio)
IP(Mus musculus)
IF(Homo sapiens)
Western blot analysis of extracts of various cell lines, using SLC7A11/xCT antibody (A2413) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of various cell lines, using SLC7A11/xCT antibody (A2413) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC7A11/xCT (Q9UPY5). Isotype IgG