быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Calnexin Rabbit mAb (A4846)
- Описание
- Характеристики
-
Overview
Product name Calnexin Rabbit mAb Catalog No. A4846 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0648 Background
This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding different isoforms have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 493-592 of human Calnexin (P27824). Sequence LPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE Gene ID Swiss Prot Synonyms CNX; P90; IP90 Calculated MW 68kDa Observed MW 90kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HepG2, K-562 Cellular location Endoplasmic reticulum, Endoplasmic reticulum membrane, Melanosome, Single-pass type I membrane protein Customer validation WB(Homo sapiens, Homo sapiens、Mus musculus)
IB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using Calnexin antibody (A4846) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 493-592 of human Calnexin (P27824). Isotype IgG