быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
eIF4A3 Rabbit mAb (A8985)
- Описание
- Характеристики
-
Overview
Product name eIF4A3 Rabbit mAb Catalog No. A8985 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1373 Background
This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a nuclear matrix protein. Its amino acid sequence is highly similar to the amino acid sequences of the translation initiation factors eIF4AI and eIF4AII, two other members of the DEAD box protein family.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-125 of human eIF4A3 (P38919). Sequence VDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKG Gene ID Swiss Prot Synonyms Fal1; RCPS; DDX48; MUK34; NUK34; NMP265; eIF4AIII; eIF4A-III; eIF-4A-III Calculated MW 47kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples PC-12, MCF7, Mouse thymus, Rat testis Cellular location Cytoplasm, Nucleus, Nucleus speckle Customer validation IF(Homo sapiens)
IP(Homo sapiens)
Western blot analysis of extracts of various cell lines, using eIF4A3 Rabbit mAb (A8985) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of U-2 OS cells using eIF4A3 Rabbit mAb (A8985) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-125 of human eIF4A3 (P38919). Isotype IgG