быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
KDM1 / LSD1 Rabbit mAb (A8711)
- Описание
- Характеристики
-
Overview
Product name KDM1 / LSD1 Rabbit mAb Catalog No. A8711 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1160 Background
This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-811 of human KDM1 / LSD1 (NP_055828.2). Sequence APILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATV Gene ID Swiss Prot Synonyms AOF2; CPRF; KDM1; LSD1; BHC110 Calculated MW 93kDa Observed MW 110kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, Jurkat, SH-SY5Y Cellular location nucleoplasm, nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using KDM1 / LSD1 antibody (A8711) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human breast cancer using KDM1 / LSD1 Rabbit mAb (A8711) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-811 of human KDM1 / LSD1 (NP_055828.2). Isotype IgG