быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
RAB11A Rabbit mAb (A3251)
- Описание
- Характеристики
-
Overview
Product name RAB11A Rabbit mAb Catalog No. A3251 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0767 Background
The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11A (P62491). Sequence ENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHV Gene ID Swiss Prot Synonyms YL8 Calculated MW 24kDa Observed MW 24kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, A549, SH-SY5Y, Mouse testis, Mouse brain, Rat testis, Rat brain, Rat spleen Cellular location Cell membrane, Cleavage furrow, Cytoplasmic side, Cytoplasmic vesicle, Lipid-anchor, Peripheral membrane protein, Recycling endosome membrane, phagosome, phagosome membrane Customer validation WB(Mus musculus, Homo sapiens)
Western blot analysis of extracts of various cell lines, using RAB11A Rabbit mAb (A3251) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Confocal imaging of HeLa cells using RAB11A Rabbit mAb (A3251, dilution 1:100) (Red).The cells were counterstained with α-Tubulin Rabbit mAb (AC049, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11A (P62491). Isotype IgG