- 100 μL
- 20 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name K48-linkage Specific Ubiquitin Rabbit mAb Catalog No. A3606 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0811 Background
This gene encodes ubiquitin, one of the most conserved proteins known. Ubiquitin has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. An aberrant form of this protein has been detected in patients with Alzheimer's disease and Down syndrome. Pseudogenes of this gene are located on chromosomes 1, 2, 13, and 17. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ubiquitin (P0CG47). Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE Gene ID Swiss Prot Synonyms HEL-S-50 Calculated MW 26kDa Observed MW 17-250kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa Cellular location Cytoplasm, Nucleus Customer validation WB(Mus musculus, Homo sapiens)

Western blot analysis of extracts of HeLa cells, using K48-linkage Specific Ubiquitin Rabbit mAb (A3606) at 1:1000 dilution.HeLa cells were treated by MG132(50 μM) at 37℃ for 90 minutes.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of C6 cells using K48-linkage Specific Ubiquitin Rabbit mAb (A3606) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using K48-linkage Specific Ubiquitin Rabbit mAb (A3606) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using K48-linkage Specific Ubiquitin Rabbit mAb (A3606) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ubiquitin (P0CG47). Isotype IgG







