быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
EDG1/HEXIM1 Rabbit mAb (A3997)
- Описание
- Характеристики
-
Overview
Product name EDG1/HEXIM1 Rabbit mAb Catalog No. A3997 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0881 Background
The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EDG1/HEXIM1 (P21453). Sequence MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTA Gene ID Swiss Prot Synonyms EDG1; S1P1; CD363; ECGF1; EDG-1; CHEDG1; D1S3362 Calculated MW 43kDa Observed MW 45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples BxPC-3, A-375, HUVEC, Mouse lung, Mouse brain, Mouse spleen, Rat lung, Rat heart Cellular location Cell membrane, Endosome, Membrane raft, Multi-pass membrane protein Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using EDG1/HEXIM1 Rabbit mAb (A3997) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EDG1/HEXIM1 (P21453). Isotype IgG